Principaux documents

Voir toute la documentation

Passer à

HPA020105

Anti-CCDC146 antibody produced in rabbit

Name: Anti-CCDC146 antibody produced in rabbit
Brand: SIGMA
Price: 564 EUR

Validation améliorée

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution, Ab2

Synonyme(s) :

Anti-Coiled-coil domain-containing protein 146

pour consulter les tarifs organisationnels et contractuels.

Sélectionner une taille de conditionnement

Changer de vue

À vous/Référence	Disponibilité	Prix
100 μL	Vérifier la disponibilité des articles du panier	564,00 €

A propos de cet article

UNSPSC Code:

12352203

NACRES:

NA.41

Human Protein Atlas Number:

HPA020105

Conjugate:

unconjugated

Clone:

polyclonal

Application:

IHC

Citations:

564,00 €

Vérifier la disponibilité des articles du panier

Service technique

Besoin d'aide ? Notre équipe de scientifiques expérimentés est là pour vous.

Laissez-nous vous aider

Propriétés

biological source

rabbit

Quality Segment

100

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies^® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

recombinant expression
Learn more about Antibody Enhanced Validation

technique(s)

immunoblotting: 0.04-0.4 μg/mL, immunohistochemistry: 1:50-1:200

immunogen sequence

KLLPAKRSLDADLAVLQIQFSQCTDRIKDLEKQFVKPDGENRARFLPGKDLTEKEMIQKLDKLELQLAKKEEKLLEKDFIYEQVSRLTDRLCSKTQGCKQDTLLLAKKMNGYQRRIK

UniProt accession no.

Q8IYE0

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... CCDC146(57639)

Description

General description

Coiled-coil domain-containing protein 146 (CCDC146) is expressed in the centrosome with a molecular weight of 112kDa.

Immunogen

Coiled-coil domain-containing protein 146 recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Features and Benefits

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Other Notes

Corresponding Antigen APREST74977

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Comparer avec des articles similaires

Voir la comparaison complète

Montrer les différences

1 of 1

Cet article	HPA020082	HPA025058	HPA035278
Sigma-Aldrich HPA020105 Anti-CCDC146 antibody produced in rabbit	Sigma-Aldrich HPA020082 Anti-CCDC146 antibody produced in rabbit	Sigma-Aldrich HPA025058 Anti-CCDC166 antibody produced in rabbit	Sigma-Aldrich HPA035278 Anti-CCDC14 antibody produced in rabbit
antibody form affinity isolated antibody	antibody form affinity isolated antibody	antibody form affinity isolated antibody	antibody form affinity isolated antibody
conjugate unconjugated	conjugate unconjugated	conjugate unconjugated	conjugate unconjugated
biological source rabbit	biological source rabbit	biological source rabbit	biological source rabbit
product line Prestige Antibodies^® Powered by Atlas Antibodies	product line Prestige Antibodies^® Powered by Atlas Antibodies	product line Prestige Antibodies^® Powered by Atlas Antibodies	product line Prestige Antibodies^® Powered by Atlas Antibodies
clone polyclonal	clone polyclonal	clone polyclonal	clone polyclonal
species reactivity human	species reactivity human	species reactivity human	species reactivity human

Still not finding the right product?

Explore all of our products under Anti-CCDC146 antibody produced in rabbit

— ou —

Essayez notre Outil de sélection de produits pour affiner vos choix.

Classe de stockage

10 - Combustible liquids

wgk

WGK 1

flash_point_f

Not applicable

flash_point_c