Wichtige Dokumente

Gesamtdokumentation anzeigen

Fortfahren mit

HPA024679

Anti-TONSL antibody produced in rabbit

Name: Anti-TONSL antibody produced in rabbit
Brand: SIGMA
Price: 564 EUR
Availability: InStock

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(e):

Anti-I-kappa-B-related protein, Anti-IkappaBR, Anti-Inhibitor of kappa B-related protein, Anti-NF-kappa-B inhibitor-like protein 2, Anti-NFKBIL2, Anti-Nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor-like 2

Anmelden zur Ansicht der Organisations- und Vertragspreise.

Größe auswählen

Ansicht ändern

Ihnen/SKU	Verfügbarkeit	Preis
100 μL	Ab HEUTE lieferbarvonSchnelldorf	564,00 €

Über diesen Artikel

UNSPSC Code:

12352203

NACRES:

NA.41

Human Protein Atlas Number:

HPA024679

Conjugate:

unconjugated

Clone:

polyclonal

Application:

IF, IHC

Citations:

564,00 €

Ab HEUTE lieferbarDetails

Technischer Dienst

Benötigen Sie Hilfe? Unser Team von erfahrenen Wissenschaftlern ist für Sie da.

Unterstützung erhalten

Eigenschaften

biological source

rabbit

Quality Segment

100

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies^® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunofluorescence: 0.25-2 μg/mL, immunohistochemistry: 1:50-1:200

immunogen sequence

WNRRNDMGETLLHRACIEGQLRRVQDLVRQGHPLNPRDYCGWTPLHEACNYGHLEIVRFLLDHGAAVDDPGGQGCEGITPLHDALNCGHFEVAELLLERGASVTLRTRK

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... NFKBIL2(4796)

Beschreibung

General description

The gene TONSL (tonsoku-like) is mapped to human chromosome 8q24.3. The protein contains three ankyrin-repeat motifs.

Immunogen

NF-kappa-B inhibitor-like protein 2 recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies^®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.
Anti-TONSL antibody produced in rabbit has been used in Western blotting.[1]

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Western Blotting (1 paper)

Biochem/physiol Actions

TONSL (tonsoku-like) associates with NF-κB (nuclear factor κ B). Mutations in TONSL increases the risk to invasive pneumococcal disease. MMS22L (MMS22 like)-TONSL complex provides genomic stability at the time of DNA replication. Mutations in ankyrin-repeat domains (present in the TONSL protein) negatively affects genome stability and cell viability.[1]

Features and Benefits

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Other Notes

Corresponding Antigen APREST70954

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Ähnliche Artikel vergleichen

Vollständigen Vergleich anzeigen

Unterschiede anzeigen

1 of 1

Dieser Artikel	HPA005941	HPA002692	HPA029207
Sigma-Aldrich HPA024679 Anti-TONSL antibody produced in rabbit	Sigma-Aldrich HPA005941 Anti-NFKBIE antibody produced in rabbit	Sigma-Aldrich HPA002692 Anti-NFKBIE antibody produced in rabbit	Sigma-Aldrich HPA029207 Anti-NFKBIA antibody produced in rabbit
description Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution	description Ab2, Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution	description Ab1, Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution	description Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
conjugate unconjugated	conjugate unconjugated	conjugate unconjugated	conjugate unconjugated
Quality Level 100	Quality Level 100	Quality Level 100	Quality Level 100
biological source rabbit	biological source rabbit	biological source rabbit	biological source rabbit
antibody form affinity isolated antibody	antibody form affinity isolated antibody	antibody form affinity isolated antibody	antibody form affinity isolated antibody
product line Prestige Antibodies^® Powered by Atlas Antibodies	product line Prestige Antibodies^® Powered by Atlas Antibodies	product line Prestige Antibodies^® Powered by Atlas Antibodies	product line Prestige Antibodies^® Powered by Atlas Antibodies
storage temp. −20°C	storage temp. −20°C	storage temp. −20°C	storage temp. −20°C

Still not finding the right product?

Explore all of our products under Anti-TONSL antibody produced in rabbit

— oder —

Probieren Sie unser Produkt-Auswahlhilfe, um Ihre Auswahl einzugrenzen

Lagerklasse

10 - Combustible liquids

wgk

WGK 1

flash_point_f

Not applicable

flash_point_c