Key Documents

View All Documentation

Anti-PPP1R17 antibody produced in rabbit

Name: Anti-PPP1R17 antibody produced in rabbit
Brand: SIGMA
Price: 607 USD
Availability: InStock

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-C7orf16, Anti-GSBS, Anti-protein phosphatase 1, regulatory subunit 17

Select a Size

Change View

Size/SKU	Availability	Price
100 μL	Check Cart for Availability	$607.00

About This Item

UNSPSC Code:

12352203

NACRES:

NA.41

Human Protein Atlas Number:

HPA047819

Conjugate:

unconjugated

Clone:

polyclonal

Application:

IF, IHC

Citations:

$607.00

Check Cart for Availability

Technical Service

Need help? Our team of experienced scientists is here for you.

Let Us Assist

Properties

biological source

rabbit

Quality Segment

100

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies^® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunoblotting: 0.04-0.4 μg/mL, immunofluorescence: 0.25-2 μg/mL, immunohistochemistry: 1:1000-1:2500

immunogen sequence

DRLDKLDPRCSHLDDLSDQFIKDCDLKKKPRKGKNVQATLNVESDQKKPRRKDTPALH

UniProt accession no.

O96001

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... PPP1R17(10842)

Description

General description

The gene PPP1R17 (protein phosphatase 1 regulatory subunit 17) is mapped to human chromosome 7p15. The gene encodes for a cGMP (cyclic guanosine monophosphate) dependent protein kinase. It is present in Purkinje cells of the cerebellum.

Immunogen

protein phosphatase 1, regulatory subunit 17 recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies^®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.
Anti-PPP1R17 antibody produced in rabbit has been used in immunohistochemistry.

Biochem/physiol Actions

PPP1R17 (protein phosphatase 1 regulatory subunit 17) might be associated with long-term depression. Presence of PPP1R17 in the hypothalamus might also be associated with food intake via the hypothalamo-pituitary-adrenal axis. PPP1R17 variants are linked with hypercholesterolemia.

Features and Benefits

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Physical form

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Other Notes

Corresponding Antigen APREST78462

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Compare Similar Items

View Full Comparison

Show Differences

1 of 1

This Item	HPA073123	HPA034500	HPA061142
Sigma-Aldrich HPA047819 Anti-PPP1R17 antibody produced in rabbit	Sigma-Aldrich HPA073123 Anti-PPP1R17 antibody produced in rabbit	Sigma-Aldrich HPA034500 Anti-PPP1R7 antibody produced in rabbit	Sigma-Aldrich HPA061142 Anti-PPP1R1B antibody produced in rabbit
description Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution	description Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody	description Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution	description Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
biological source rabbit	biological source rabbit	biological source rabbit	biological source rabbit
antibody form affinity isolated antibody	antibody form affinity isolated antibody	antibody form affinity isolated antibody	antibody form affinity isolated antibody
conjugate unconjugated	conjugate unconjugated	conjugate unconjugated	conjugate unconjugated
Quality Level 100	Quality Level -	Quality Level 100	Quality Level 100
product line Prestige Antibodies^® Powered by Atlas Antibodies	product line Prestige Antibodies^® Powered by Atlas Antibodies	product line Prestige Antibodies^® Powered by Atlas Antibodies	product line Prestige Antibodies^® Powered by Atlas Antibodies
technique(s) immunohistochemistry: 1:1000-1:2500, immunoblotting: 0.04-0.4 μg/mL, immunofluorescence: 0.25-2 μg/mL	technique(s) immunofluorescence: 0.25-2 μg/mL	technique(s) immunohistochemistry: 1:1000-1:2500, immunofluorescence: 0.25-2 μg/mL, immunoblotting: 0.04-0.4 μg/mL	technique(s) immunohistochemistry: 1:200- 1:500

Still not finding the right product?

Explore all of our products under Anti-PPP1R17 antibody produced in rabbit

— or —

Try our Product Selector Tool to narrow your options

Storage Class

10 - Combustible liquids

WGK

WGK 1

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

It looks like we've run into a problem, but you can still download Certificates of Analysis from our Documents section.

If you need assistance, please contact Customer Support

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.