HPA007603

Anti-RIOX2 antibody produced in rabbit

Name: Anti-RIOX2 antibody produced in rabbit
Brand: SIGMA
Price: 3178 BRL

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Sinônimo(s):

FLJ14393, JMJD10, MINA, MINA53, NO52, mdig

Slide 1 of 4

Faça login para ver os preços organizacionais e de contrato.

Selecione um tamanho

100 μL

R$ 3.178,00

Verificar disponibilidade no carrinho

Sobre este item

UNSPSC Code:

12352203

NACRES:

NA.43

Human Protein Atlas Number:

HPA007603

Documentos Principais

Visualizar Toda a Documentação

Pular para

Assistência Técnica

Precisa de ajuda? Nossa equipe de cientistas experientes está à sua disposição.

Estamos aqui para ajudar

Nome do produto

Anti-RIOX2 antibody produced in rabbit, Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies^® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

orthogonal RNAseq
recombinant expression
Learn more about Antibody Enhanced Validation

technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:20-1:50

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Comparar Itens Semelhantes

Ver Comparação Total

Mostrar diferenças

1 of 4

Este Item	HPA008080	HPA005681	SAB2109100
Sigma-Aldrich HPA007603 Anti-RIOX2 antibody produced in rabbit	Sigma-Aldrich HPA008080 Anti-RIOX2 antibody produced in rabbit	Sigma-Aldrich HPA005681 Anti-RIOK2 antibody produced in rabbit	Sigma-Aldrich SAB2109100 Anti-RIOK2 antibody produced in rabbit
Quality Level 100	Quality Level 100	Quality Level 100	Quality Level -
conjugate unconjugated	conjugate unconjugated	conjugate unconjugated	conjugate -
antibody form affinity isolated antibody	antibody form affinity isolated antibody	antibody form affinity isolated antibody	antibody form affinity isolated antibody
biological source rabbit	biological source rabbit	biological source rabbit	biological source rabbit
product line Prestige Antibodies^® Powered by Atlas Antibodies	product line Prestige Antibodies^® Powered by Atlas Antibodies	product line Prestige Antibodies^® Powered by Atlas Antibodies	product line -
species reactivity human	species reactivity human	species reactivity human	species reactivity -

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Biochem/physiol Actions

MINA (MYC induced nuclear antigen) gene encodes an oxygenase that functions as a histone lysine demethylase and a ribosomal histidine hydroxylase. It catalyzes the demethylation of trimethylated Lys-9 on histone H3 (H3K9me3), which results in an increase in ribosomal RNA expression. It functions in mammalian cell proliferation and cell growth. MINA catalyzes histidyl hydroxylation of Rpl27a, a ribosomal protein. It is associated with the development of cancer and its expression has been observed in human lung cancer tissues. It may serve as a prognostic marker for esophageal squamous cell carcinoma.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Features and Benefits

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Immunogen

ribosomal oxygenase 2 recombinant protein epitope signature tag (PrEST)

Sequence
MPKKAKPTGSGKEEGPAPCKQMKLEAAGGPSALNFDSPSSLFESLISPIKTETFFKEFWEQKPLLIQRDDPALATYYGSLFKLTDLKSLCSRGMYYGRDVNVCRCVNGKKKVLNKDGKAHFLQLRKDFDQKRATIQFHQPQRFKDELW

Other Notes

Corresponding Antigen APREST71310

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Não está encontrando o produto certo?

Experimente o nosso Ferramenta de seleção de produtos.

Classe de armazenamento

10 - Combustible liquids

wgk

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable

ppe

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

Escolha uma das versões mais recentes:

Certificados de análise (COA)

Lot/Batch Number

R01137

Não está vendo a versão correta?

Se precisar de uma versão específica, você pode procurar um certificado específico pelo número do lote ou da remessa.

Pesquise por COA

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

Oxygenase-catalyzed ribosome hydroxylation occurs in prokaryotes and humans.

Wei Ge et al.

Nature chemical biology, 8(12), 960-962 (2012-10-30)

The finding that oxygenase-catalyzed protein hydroxylation regulates animal transcription raises questions as to whether the translation machinery and prokaryotic proteins are analogously modified. Escherichia coli ycfD is a growth-regulating 2-oxoglutarate oxygenase catalyzing arginyl hydroxylation of the ribosomal protein Rpl16. Human

Lung cancer-associated JmjC domain protein mdig suppresses formation of tri-methyl lysine 9 of histone H3.

Yongju Lu et al.

Cell cycle (Georgetown, Tex.), 8(13), 2101-2109 (2009-06-09)

Lung cancer is the most common cancer worldwide, accounting for 1.3 million cancer deaths annually. Despite extensive studies over the past decade, the detailed mechanism about the initiation and development of the lung cancer is still elusive. In the present

A novel myc target gene, mina53, that is involved in cell proliferation.

Makoto Tsuneoka et al.

The Journal of biological chemistry, 277(38), 35450-35459 (2002-07-02)

Myc is a ubiquitous mediator of cell proliferation and can transactivate the expression of various genes through E-box sites. Here we report a novel gene, mina53 (Myc-induced nuclear antigen with a molecular mass of 53 kDa). The mina53 gene encodes

The Human mineral dust-induced gene, mdig, is a cell growth regulating gene associated with lung cancer.

Yadong Zhang et al.

Oncogene, 24(31), 4873-4882 (2005-05-18)

Environmental or occupational exposure to mineral dusts, mainly silica and asbestos, is associated with an increased incidence of lung inflammation, fibrosis, and/or cancer. To better understand the molecular events associated with these pulmonary diseases, we attempted to identify genes that

Conteúdo relacionado

Procedure for Fixation Immunostaining and Imaging in 384-well Plates

Prestige Antibodies Immunofluorescence Procedure

Questions

Reviews

No rating value

Active Filters

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica