AV48996

Anti-GPT2 antibody produced in rabbit

affinity isolated antibody

• Synonyme(s) : Anti-ALT2, Anti-Glutamic pyruvate transaminase (alanine aminotransferase) 2
• NACRES: NA.41
• UNSPSC Code: 12352203

Propriétés

• Nom du produit: Anti-GPT2 antibody produced in rabbit, affinity isolated antibody
• biological source: rabbit
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 58 kDa
• species reactivity: human, rat, rabbit, dog, bovine, horse, mouse, guinea pig
• concentration: 0.5 mg - 1 mg/mL
• technique(s): western blot: suitable
• NCBI accession no.: NP_597700
• UniProt accession no.: Q8TD30
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Quality Level: 100
• Gene Information: human ... GPT2(84706)

Description

Application

Anti-GPT2 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.

Biochem/physiol Actions

Glutamic pyruvate transaminase (alanine aminotransferase) 2 (GPT2; ALT2) is an enzyme that participates in the reversible transamination reaction that yields glutamate and pyruvate during gluconeogenesis.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the C terminal region of human GPT2

Other Notes

Synthetic peptide located within the following region: PEYSSNVELASFHSTSKGYMGECGYRGGYMEVINLHPEIKGQLVKLLSVR

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Informations sur la sécurité

• Classe de stockage: 10 - Combustible liquids
• wgk: WGK 3
• flash_point_f: Not applicable
• flash_point_c: Not applicable