This product is native myoglobin isolated from equine heart.
M1882
Myoglobin from equine heart
≥90% (SDS-PAGE), essentially salt-free, lyophilized powder
Myoglobin from equine heart
1 of 1 reviewers took part in a promotion
Synonym(s):
Myoglobin from horse heart
Sign In to View Organizational & Contract Pricing
Select a Size
250 MG
$114.00
1 G
$404.00
5 G
$1,620.00
10 G
$2,790.00
About This Item
Skip To
biological source
equine heart
assay
≥90% (SDS-PAGE)
form
essentially salt-free, lyophilized powder
Iron content
≥0.20%
technique(s)
MALDI-MS: suitable
UniProt accession no.
storage temp.
−20°C
Gene Information
horse ... MB(100054434)
Looking for similar products? Visit Product Comparison Guide
1 of 4
This Item | C7752 | C2506 | M4824 |
|---|---|---|---|
| technique(s) MALDI-MS: suitable | technique(s) cell culture | mammalian: suitable | technique(s) cell based assay: suitable | technique(s) - |
| assay ≥90% (SDS-PAGE) | assay ≥95% (SDS-PAGE), ≥95% based on Mol. Wt. 12,384 basis | assay ≥95% (SDS-PAGE) | assay - |
| biological source equine heart | biological source horse heart | biological source horse heart | biological source human heart |
| form essentially salt-free, lyophilized powder | form powder | form powder | form lyophilized |
| UniProt accession no. | UniProt accession no. | UniProt accession no. | UniProt accession no. |
| Gene Information horse ... MB(100054434) | Gene Information horse ... CYCS(100053958) | Gene Information horse ... CYCS(100053958) | Gene Information human ... MYL1(4632), MYL2(4633), MYL3(4634) |
Application
Myoglobin from equine heart is suitable for use in:
- spectral measurements in Beckman DU-50 or Gilford 2400 spectrophotometer[1]
- the secondary structure analysis of proteins in H2O solution using single-pass attenuated total reflection Fourier transform infrared (ATR-FT-IR) microscopy[2]
- the calibration of the mass scale at a concentration of 2 pmol/μL in Electrospray mass spectrometry[3]
- a study to investigate on-line single droplet deposition for MALDI mass spectrometry[4]
- a study to examine protein adsorption in fused-silica and polyacrylamide-coated capillaries[5]
Biochem/physiol Actions
Myoglobin is a mobile carrier of oxygen that is developed in red muscle and heart cells. This happens as a response to elevated demand for oxygen during exercise, and transports oxygen from the sarcolemma to the mitochondria of vertebrate heart and red muscle cells.[6]
used together
Product No.
Description
Pricing
Storage Class
11 - Combustible Solids
wgk_germany
WGK 3
flash_point_f
Not applicable
flash_point_c
Not applicable
ppe
Eyeshields, Gloves, type N95 (US)
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Laurent Marichal et al.
Langmuir : the ACS journal of surfaces and colloids, 36(28), 8218-8230 (2020-06-26)
Protein adsorption on nanoparticles is an important field of study, particularly with regard to nanomedicine and nanotoxicology. Many factors can influence the composition and structure of the layer(s) of adsorbed proteins, the so-called protein corona. However, the role of protein
Ursula Waack et al.
mBio, 9(6) (2018-12-20)
Antibiotic-resistant Acinetobacter baumannii is increasingly recognized as a cause of difficult-to-treat nosocomial infections, including pneumonia, wound infections, and bacteremia. Previous studies have demonstrated that the metalloprotease CpaA contributes to virulence and prolongs clotting time when added to human plasma as
D H Robertson et al.
Rapid communications in mass spectrometry : RCM, 11(7), 786-790 (1997-01-01)
Major urinary proteins (MUPs) from the urine of individual wild mice were characterized using electrospray ionization mass spectrometry (ESI-MS) and compared to MUPs from the urine of inbred mice. The wild mice showed considerable variation between individuals in the expression
Hajime Shigemitsu et al.
Nature communications, 11(1), 3859-3859 (2020-08-02)
Non-enzymatic proteins including antibodies function as biomarkers and are used as biopharmaceuticals in several diseases. Protein-responsive soft materials capable of the controlled release of drugs and proteins have potential for use in next-generation diagnosis and therapies. Here, we describe a
Brandye M Smith et al.
Analytical chemistry, 74(16), 4076-4080 (2002-08-30)
The application of single-pass attenuated total reflection Fourier transform infrared (ATR-FT-IR) microscopy was investigated for secondary structure analysis of 15 representative proteins in H2O solution. This is the first reported application of single-pass ATR-FT-IR for protein analysis; thus, the method
Articles
Rapid trypsin digest kit yields reliable results in less than 2 hours for mass spectrometry analysis.
Chromatograms
application for HPLC
-
Was this product recombinantly expressed or was it isolated directly from the heart of the horse ?
1 answer-
Helpful?
-
-
Is equine myoglobin (M1882) detectable and quantifiable by common laboratory tests (ECL) for the detection of human myoglobin?
1 answer-
This item has not been tested in-house for detectability and quantifiability by common laboratory tests. The specifications for this item do not include testing by these methods.
Helpful?
-
-
What is the molecular weight of Product M1882, Myoglobin from equine heart?
1 answer-
Based on the amino acid sequence (16,950) plus the heme group (616), the molecular weight is approximately 17,600 g/mol.
Helpful?
-
-
What is the Department of Transportation shipping information for this product?
1 answer-
Transportation information can be found in Section 14 of the product's (M)SDS.To access the shipping information for this material, use the link on the product detail page for the product.
Helpful?
-
-
Is Product M1882, Myoglobin from equine heart, oxidized?
1 answer-
Yes, it is oxidized.
Helpful?
-
-
Which has more affinity for oxygen, hemoglobin or myoglobin?
1 answer-
The affinity of myoglobin for oxygen is higher than that of hemoglobin.
Helpful?
-
-
Is Product M1882, Myoglobin from equine heart, metmyoglobin?
1 answer-
The M1882 is a mixture, but we have not analyzed the percentages of the oxidized myoglobin or the reduced myoglobin in the product.
Helpful?
-
-
Do you have the sequence for Product M1882, Myoglobin from equine heart?
1 answer-
Product M1882 - Myoglobin from equine heart is purified from equine heart. It is not sequenced.Accession P68082 for equine myoglobin has the following sequenceMGLSDGEWQQVLNVWGKVEADIAGHGQEVLIRLFTGHPETLEKFDKFKHLKTEAEMKASE DLKKHGTVVLTALGGILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISDAIIHVLHSKHPGDFGADAQGAMTKALELFRNDIAAKYKELGFQGI hope that you find this information helpful.If you have further questions, please reply to this email.Sincerely,Audrey FlemingSigma-Aldrich Technical Service
Helpful?
-
Active Filters
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service