MSST0007

SILu^™Prot CLU Clusterin human

recombinant, expressed in HEK 293 cells, SIL MS Protein Standard, ¹³C and ¹⁵N-labeled

• Synonym(s): Apolipoprotein J, Clusterin, Testosterone-repressed prostate message 2 (TRPM-2)
• NACRES: NA.12
• UNSPSC Code: 23201100

Properties

• Product Name: SILu^™Prot CLU Clusterin human, recombinant, expressed in HEK 293 cells, SIL MS Protein Standard, ¹³C and ¹⁵N-labeled
• biological source: human
• recombinant: expressed in HEK 293 cells
• tag: His tagged; V5 tagged
• assay: ≥98% (SDS-PAGE)
• form: lyophilized powder
• potency: ≥98% Heavy amino acids incorporation efficiency by MS
• mol wt: 56811.45
• technique(s): mass spectrometry (MS): suitable
• suitability: suitable for mass spectrometry
• UniProt accession no.: P10909
• storage temp.: −20°C
• Quality Level: 200
• Gene Information: human ... CLU(1191)

Description

Biochem/physiol Actions

Clusterin is a secreted glycosylated, 80-kDa disulfide-linked heterodimer of alpha and beta subunits (produced by internal cleavage). Clusterin is expressed in virtually all tissues and found in all human fluids. It is involved in numerous physiological processes important for carcinogenesis and tumor growth, including anti-apoptotic cell survival, cell cycle regulation, cell adhesion, tissue remodeling and lipid transportation. Clusterin also exists as a nuclear protein. The secreted form of Clusterin has extracellular chaperone and anti-apoptotic activities while the nuclear form acts as a proapoptotic factor.

General description

SILu^™ Prot Clusterin is a recombinant, stable isotope-labeled human Clusterin which incorporates [¹³C₆, ¹⁵N₄]-Arginine and [¹³C₆, ¹⁵N₂]-Lysine. Expressed in human 293 cells, it is designed to be used as an internal standard for bioanalysis of Clusterin in mass-spectrometry. SIL^™ Prot Clusterin is a heterodimer of 2 subunits (alpha and beta) consisting of 427 amino acids (including N-terminal polyhistidine and V5 tags), with a calculated molecular weight of 50 kDa.

Other Notes

DQTVSDNELQEMSNQGSKYVNKEIQNAVNGVKQIKTLIEKTNEERKTLLSNLEEAKKKKEDALNETRESETKLKELPGVCNETMMALWEECKPCLKQTCMKFYARVCRSGSGLVGRQLEEFLNQSSPFYFWMNGDRIDSLLENDRQQTHMLDVMQDHFSRASSIIDELFQDRFFTREPQDTYHYLPFSLPHRRPHFFFPKSRIVRSLMPFSPYEPLNFHAMFQPFLEMIHEAQQAMDIHFHSPAFQHPPTEFIREGDDDRTVCREIRHNSTGCLRMKDQCDKCREILSVDCSTNNPSQAKLRRELDESLQVAERLTRKYNELLKSYQWKMLNTSSLLEQLNEQFNWVSRLANLTQGEDQYYLRVTTVASHTSDSDVPSGVTEVVVKLFDSDPITVTVPVEVSRKNPKFMETVAEKALQEYRKKHREESDPSRGPFEGKPIPNPLLGLDSTRTGHHHHHHHHGGQ

Physical form

Supplied as a lyophilized powder containing phosphate buffered saline.

Legal Information

SILu is a trademark of Sigma-Aldrich Co. LLC

Safety Information

• Storage Class: 13 - Non Combustible Solids
• wgk: WGK 1
• flash_point_f: Not applicable
• flash_point_c: Not applicable