APREST77458

PrEST Antigen MFGE8

Prestige Antigens^™ Powered by Atlas Antibodies, buffered aqueous solution

• Sinonimo/i: BA46, EDIL1, HsT19888, MFG-E8, hP47
• UNSPSC Code: 12352202

Proprietà

• recombinant: expressed in E. coli
• assay: >80% (SDS-PAGE)
• form: buffered aqueous solution
• mol wt: predicted mol wt 35 kDa
• purified by: immobilized metal affinity chromatography (IMAC)
• concentration: ≥0.5 mg/mL
• immunogen sequence: LKNNSIPDKQITASSSYKTWGLHLFSWNPSYARLDKQGNFNAWVAGSYGNDQWLQVDLGSSKEVTGIITQGARNFGSVQFVASYKVAYSNDSANWTEYQDPRTGSSKIFPGNWDNHSHKKNLFETPILARYVRILPVAWHNRIALRLEL
• Ensembl | human accession no.: ENSG00000140545
• UniProt accession no.: Q08431
• shipped in: wet ice
• storage temp.: −20°C
• Gene Information: human ... MFGE8(4240)

Descrizione

General description

Recombinant protein fragment of Human MFGE8 with N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) fusion tag.

Application

Suitable as a blocking agent using corresponding antibodies.

Physical form

Solution in 1 M urea-PBS, pH 7.4

Preparation Note

The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.

Other Notes

Corresponding Antibody HPA002807.

Legal Information

Prestige Antigens is a trademark of Sigma-Aldrich Co. LLC

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Classe di stoccaggio: 10 - Combustible liquids
• wgk: WGK 2
• flash_point_f: Not applicable
• flash_point_c: Not applicable