Autenticati per visualizzare i prezzi organizzativi e contrattuali.
Scegli un formato
Informazioni su questo articolo
UNSPSC Code:
12352202
Servizio Tecnico
Hai bisogno di aiuto? Il nostro team di scienziati qualificati è a tua disposizione.
Permettici di aiutartiServizio Tecnico
Hai bisogno di aiuto? Il nostro team di scienziati qualificati è a tua disposizione.
Permettici di aiutartirecombinant
expressed in E. coli
assay
>80% (SDS-PAGE)
form
buffered aqueous solution
mol wt
predicted mol wt 35 kDa
purified by
immobilized metal affinity chromatography (IMAC)
concentration
≥0.5 mg/mL
immunogen sequence
LKNNSIPDKQITASSSYKTWGLHLFSWNPSYARLDKQGNFNAWVAGSYGNDQWLQVDLGSSKEVTGIITQGARNFGSVQFVASYKVAYSNDSANWTEYQDPRTGSSKIFPGNWDNHSHKKNLFETPILARYVRILPVAWHNRIALRLEL
Ensembl | human accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
Gene Information
human ... MFGE8(4240)
General description
Recombinant protein fragment of Human MFGE8 with N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) fusion tag.
Application
Suitable as a blocking agent using corresponding antibodies.
Physical form
Solution in 1 M urea-PBS, pH 7.4
Preparation Note
The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
Other Notes
Corresponding Antibody HPA002807.
Legal Information
Prestige Antigens is a trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Classe di stoccaggio
10 - Combustible liquids
wgk
WGK 2
flash_point_f
Not applicable
flash_point_c
Not applicable
Scegli una delle versioni più recenti:
Possiedi già questo prodotto?
I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.
Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..
Contatta l'Assistenza Tecnica