recombinant
expressed in E. coli
assay
>80% (SDS-PAGE)
form
buffered aqueous solution
mol wt
predicted mol wt 35 kDa
purified by
immobilized metal affinity chromatography (IMAC)
concentration
≥0.5 mg/mL
immunogen sequence
LKNNSIPDKQITASSSYKTWGLHLFSWNPSYARLDKQGNFNAWVAGSYGNDQWLQVDLGSSKEVTGIITQGARNFGSVQFVASYKVAYSNDSANWTEYQDPRTGSSKIFPGNWDNHSHKKNLFETPILARYVRILPVAWHNRIALRLEL
Ensembl | human accession no.
UniProt accession no.
shipped in
wet ice
General description
Recombinant protein fragment of Human MFGE8 with N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) fusion tag.
Application
Suitable as a blocking agent using corresponding antibodies.
Physical form
Solution in 1 M urea-PBS, pH 7.4
Preparation Note
The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
Other Notes
Corresponding Antibody HPA002807.
Legal Information
Prestige Antigens is a trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Classe de armazenamento
10 - Combustible liquids
wgk
WGK 2
flash_point_f
Not applicable
flash_point_c
Not applicable
Escolha uma das versões mais recentes:
Já possui este produto?
Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.
Número de item de comércio global
| SKU | GTIN |
|---|---|
| APREST77458-100UL | 04061835925087 |
Active Filters
Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.
Entre em contato com a assistência técnica